Products
MGF 2mg/vial Peptides
Product Introduction:
MGF | Mechano Growth Factor – a unique splice variant of insulin-like growth factor-1 (IGF-1). As a targeted muscle repair peptide, MGF activates the mTOR signaling pathway to potently stimulate muscle stem cell proliferation and protein synthesis—accelerating damaged muscle tissue recovery and driving functional muscle hypertrophy. Ideal for sports injury rehabilitation (tendon, ligament, muscle) and muscle-building cycles, it enables localized injection targeting with ZERO risk of systemic hormonal interference, delivering precise, targeted results for fitness and recovery needs.
MGF 2mg/vial Pharmaceutical Grade Lyophilized Powder | Mechano-Growth Factor ≥98% Purity
Basic Parameters
Amino acid sequence : YQPPSTNKNTKSQRRKGSTFEEHKNYSPLRWGLLP
Molecular weight : 2674.9 Da | Purity : ≥98% (HPLC) | Specification : 2mg/bottle
Appearance : White freeze-dried powder | Production : Genetic recombination (endotoxin-free) | Process : Sterile lyophilization (activity/stability guaranteed)
Core Biological Properties & Usage
As a muscle-specific local growth factor, MGF is a gold standard for muscle injury repair, local muscle hyperplasia, and exercise recovery research:
✅ Targeted Repair : Activate satellite cell proliferation/differentiation, repair muscle fibers, increase muscle fiber quantity/size
✅ Fast Recovery : Accelerate strain/tear healing, reduce scar tissue, maintain muscle elasticity
✅ Performance Boost : Enhance muscle mass/strength, reduce post-training soreness, speed up recovery
✅ Safe Local Action : Muscle tissue-specific (no systemic circulation), no hormonal activity, no endocrine disruption, 5-10 minute half-life (immediate local injection only)
Quality Assurance & Shipping
✅ GMP-compliant production | Batch-by-batch HPLC purity testing | Third-party COA included
✅ Sterile medical vial + rubber stopper seal | Ice pack transportation (peptide activity protection)
✅ Worldwide shipping | Private unmarked outer packaging (discreet delivery)
Precautions : Mild local redness/swelling may occur (short-lived); use immediately post-training/injury; inject directly into muscle tissue (avoid subcutaneous retention). Recommended dose: 100-200mcg/time, 2-3 times/week.
Why Choose Our MGF?
Irreplaceable local muscle repair efficacy | Targeted action (zero systemic side effects) | High sports medicine value (injury recovery/functional reconstruction) | Professional technical guidance for custom research plans.
Contact Us : For technical support or orders → https://acdcsource.com
